Skip to main content

Ultra Pure Peptides - Research Use Only - Raw Material Sourced from the USA

Vasoactive Intestinal Peptide (VIP)

$97.75

SKU: vip-peptide Category:

Pickup available at Islip

Usually ready in 24 hours

View store information

Vasoactive Intestinal Peptide (VIP)

Islip

Pickup available, usually ready in 24 hours

3 Grant Ave.
Ste. B
Islip NY 11751
United States
+16316770030

VIP is a 28-amino acid neuropeptide initially discovered in the small intestine but now known to be distributed widely throughout the nervous, immune, cardiovascular, and endocrine systems. It plays a vital role in regulating smooth muscle activity, vasodilation, neurotransmission, circadian rhythms, immune modulation, and pulmonary and gastrointestinal health. Due to its broad activity, VIP is being explored for use in respiratory, autoimmune, neurological, and metabolic conditions.

Applications
  • Gastrointestinal motility and secretion regulation
  • Asthma and COPD (bronchodilation and inflammation control)
  • Immune system modulation in autoimmune diseases
  • Neuroprotection and circadian rhythm regulation
  • Hormone secretion modulation (insulin, glucagon, pituitary hormones)
  • Cardiovascular support via vasodilation and improved blood flow
  • Potential therapeutic target for migraines
Mechanism of Action

VPAC1 Receptor Binding: Found in intestines, lungs, CNS, and immune cells—modulates inflammation, digestion, and neurotransmission
VPAC2 Receptor Binding: Expressed in pancreas, endocrine glands, and smooth muscle—affects hormone secretion and muscle tone
cAMP Pathway Activation via Gs Protein: Activates adenylate cyclase → increases cAMP → activates PKA → modulates gene expression, enzyme activity, and ion channel function
Smooth Muscle Relaxation and Immune Regulation: Leads to bronchodilation, vasodilation, and anti-inflammatory signaling

Key Research Studies

1. Gut Microbiota and Metabolic Balance

  • Study focus: Role of VIP in gut health
  • Findings: VIP-deficient mice had disrupted microbiota diversity and weight loss
  • Reference:Frontiers

2. Growth and Metabolic Regulation

  • Study focus: VPAC2 receptor knockout models
  • Findings: Reduced fat mass, increased insulin sensitivity, and higher metabolism in VIP signaling-deficient mice
  • Reference:  PMC

3. Pulmonary Function (COPD Therapy)

  • Study focus: Inhaled VIP (Aviptadil) in COPD patients
  • Findings: Improved exercise capacity (6-minute walk test) after 6 months
  • Reference: Chest Journal

4. Migraine Induction

  • Study focus: VIP infusion in healthy subjects
  • Findings: Induced migraine attacks in 71% of participants vs. 5% in placebo group
  • Reference: Randomized Clinical Trial

Biological Effects and Benefits

Gastrointestinal Support

Promotes smooth muscle relaxation, digestion, and fluid secretion

Vasodilation

Enhances blood flow and reduces blood pressure

Neuroprotection

Involved in memory, circadian rhythm regulation, and thermoregulation

Immune Modulation

Reduces pro-inflammatory cytokines and supports immune balance

Biological Effects Image

Bronchodilation

Helps treat asthma and COPD by relaxing airway smooth muscle

Endocrine Support

Regulates insulin, glucagon, and hypothalamic-pituitary hormones

Metabolic Regulation

Influences fat metabolism, insulin sensitivity, and body composition

Molecular Structure

Molecular Structure
  • Peptide Sequence: HSDAVFTDNYTLDQITYTKPESFNSSEIKR
  • Molecular Formula: C152H252N44O47S2
  • Molecular Weight: ~3,300 Da
  • Structure Notes: Linear peptide with broad receptor interactions (VPAC1 and VPAC2)